HIF1AN/FIH-1 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2719
Product Name:  HIF1AN/FIH-1 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect HIF1AN/FIH-1
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human HIF1AN/FIH-1 aa 2-254.
Immunogen Sequence:  AATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPR AEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFL YYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLN DTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYD EQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYER FPN
Host:  Rabbit
Isotype:  IgG
Purification:  Protein G purified
Appearance:  Liquid
Formulation:  pH: 7.40; 0.03% Proclin, 50% Glycerol, PBS
Applications:  IP, IHC-P, WB, ICC/IF
Species Reactivity:  Mouse, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9NWT6
Alternative Name:  DKFZp762F1811 antibody/Factor inhibiting HIF-1 antibody/Factor inhibiting HIF1 antibody
Scientific Background:  Hydroxylates HIF-1 alpha at 'Asp-803' in the C-terminal transactivation domain (CAD). Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300-interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.