| Cat.No.: | EAb-2773 |
| Product Name: | SIRT6 Monoclonal Antibody (OTI1G3) |
| Product Overview: | Mouse monoclonal (OTI1G3) to detect SIRT6 |
| Antibody Type: | Monoclonal |
| Clone Designation: | OTI1G3 |
| Immunogen: | Recombinant fragment corresponding to Human SIRT6 aa 88-352. Produced in E.coli |
| Immunogen Sequence: | SARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMF VEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILD WEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLV IVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALP PLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPT SPAPHRPPKRVKAKA |
| Host: | Mouse |
| Isotype: | IgG1 |
| Purification: | Affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.30; 0.02% Sodium azide, PBS, 50% Glycerol, 1% BSA |
| Applications: | WB, ICC/IF |
| Recommended Dilutions/Conditions: |
Western Blot 1:500-2000; Immunocytochemistry/Immunofluorescence 1:100 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Species Reactivity: | Dog, Human, African green monkey |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q8N6T7; NP_057623 |
| Alternative Name: | 2810449N18Rik antibody/AI043036 antibody/Mono ADP ribosyltransferase sirtuin 6 antibody |
| Scientific Background: | NAD-dependent protein deacetylase. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Acts as a corepressor of the transcription factor HIF1A to control the expression of multiple glycolytic genes to regulate glucose homeostasis. Required for genomic stability. Regulates the production of TNF protein. Has a role in the regulation of life span (By similarity). Deacetylation of nucleosomes interferes with RELA binding to target DNA. May be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. Required for genomic stability. Required for normal IGF1 serum levels and normal glucose homeostasis. Modulates cellular senescence and apoptosis. On DNA damage, promotes DNA end resection via deacetylation of RBBP8. Has very weak deacetylase activity and can bind NAD(+) in the absence of acetylated substrate. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
| EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
| EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
| SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
| Related Gene / Proteins | |||
| Siah2 | SIK1 | SIMC1 | SIN3A |
| SIN3B | SIP1 | Sir2p | SIRT |
| SIRT1 | SIRT2 | SIRT3 | SIRT4 |
| SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
