Dnmt2 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3207
Product Name:  Dnmt2 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect Dnmt2
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human Dnmt2 aa 188-278.
Immunogen Sequence:  KIESVHPQKYAMDVENKIQEKNVEPNISFDGSIQCSGKDAILFKLETAEE IHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYAL
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol
Applications:  ICC/IF, IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  O14717
Alternative Name:  dDNMT antibody/DmMT 2 antibody/DmMT2 antibody
Scientific Background:  Specifically methylates cytosine 38 in the anticodon loop of tRNA(Asp).

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.