EZH2 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-3264
Product Name:  EZH2 Polyclonal Antibody
Antibody Type:  Polyclonal
Immunogen:  Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human EZH2
Immunogen Sequence:  LERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELI
Host:  Rabbit
Isotype:  IgG
Molecular Weight:  105kDa
Purification:  Affinity purification
Appearance:  Liquid
Applications:  WB; IP
Recommended Dilutions/Conditions:  WB: 1:500 - 1:2000; IP: 1:50 - 1:100
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Species Reactivity:  Human
Storage:  -20℃.
Storage Buffer:  PBS with 0.02% sodium azide,50% glycerol,pH7.3.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Swiss Prot Q15910; NP_001190176.1; Gene ID 2146
Alternative Name:  EZH2; ENX-1; ENX1; EZH1; EZH2b; KMT6; KMT6A; WVS; WVS2; histone-lysine N-methyltransferase EZH2
Scientific Background:  This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene.
Product Types
◆ Bioactive Small Molecules
BSM-0006 GSK343 Inquiry
BSM-0059 3-Deazaneplanocin A Inquiry
BSM-0060 3-Deazaneplanocin A hydrochloride Inquiry
◆ Extracts & Lysates
EL-0024 Recombinant Human EZH1 293 Cell Lysate Inquiry
EL-0025 Recombinant Human EZH2 293 Cell Lysate Inquiry
Related Gene / Proteins
ezh1 EZH2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.