Cat.No.: | EAb-3334 |
Product Name: | JARID1B Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 784-883 of human JARID1B |
Immunogen Sequence: | EESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEE |
Host: | Rabbit |
Isotype: | IgG |
Molecular Weight: | 176kDa |
Purification: | Affinity purification |
Appearance: | Liquid |
Applications: | WB |
Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Positive Control: | HeLa,Mouse brain,Rat brain |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20℃. |
Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
Warning: | For Research Use Only! Not For Use in Humans. |
Accession: | Swiss Prot Q9UGL1; NP_006609.3; Gene ID 10765 |
Alternative Name: | KDM5B; CT31; JARID1B; PLU-1; PLU1; PPP1R98; PUT1; RBBP2H1A; RBP2-H1; lysine demethylase 5B |
Scientific Background: | This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing results in multiple transcript variants. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0002 | AT9283 | Inquiry |
◆ Cell Lines | ||
CL-0017 | Human JARID2 Knockout Cell Line 11bp deletion | Inquiry |
CL-0081 | Human JARID2 Knockout Cell Line 11bp deletion | Inquiry |
◆ Antibodies | ||
EAb-0079 | JARID2 Polyclonal Antibody | Inquiry |
EAb-0080 | JARID1C Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
JADE1 | JAK | JAK1 | JAK2 |
JAK3 | JAKMIP1 | JARID | JARID1 |
JARID1A | JARID1B | JARID1C | JARID2 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools