| Cat.No.: | EAb-3338 |
| Product Name: | UBE2E1 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human UBE2E1 |
| Immunogen Sequence: | MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB |
| Recommended Dilutions/Conditions: |
WB: 1:200 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Species Reactivity: | Human,Mouse,Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot P51965; NP_003332.1; Gene ID 7324 |
| Alternative Name: | UBE2E1; UBCH6; ubiquitin-conjugating enzyme E2 E1 |
| Scientific Background: | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0026 | Human UBAP1 Knockout Cell Line | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0162 | Synthetic Human Ubiquitin protein (Biotin) | Inquiry |
| SP-0163 | Human Ubiquitin peptide | Inquiry |
| ◆ Antibodies | ||
| EAb-0174 | UBE2G1 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0315 | NSC 697923 | Inquiry |
| Related Gene / Proteins | |||
| UB2D1 | UB2D2 | UB2D3 | UB2R1 |
| UBA1 | UBA5 | UBA7 | UBAP1 |
| UBB | UBC | UBC12 | Ubc13 |
| Ubc3B | UbcH1 | UbcH2 | UbcH3 |
| UbcH5a | UbcH5b | UbcH5c | UbcH8 More > |
| UBD | UBE1L | UBE2B | UBE2C |
| UBE2D1 | UBE2D3 | UBE2DNL | UBE2E1 |
| UBE2E2 | UBE2E3 | UBE2G1 | UBE2G2 |
| UBE2H | UBE2I | UBE2K | UBE2L3 |
| UBE2L6 | UBE2M | UBE2N | UBE2O |
| UBE2Q2 | UBE2R1 | UBE2R2 | UBE2T |
| UBE2V1 | UBE2V2 | UBE2W | UBE3A |
| Ube4a | Ubiquitin | UBL7 | Ubn1 |
| UBP5 | UBR2 | UBTD1 | UBTD2 |
| UBXN10 | UBXN2B | UBXN6 | UBXN8 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
