Cat.No.: | PE-0245 |
Product Name: | Recombinant Human EZH2 Protein, His-tagged |
Product Overview: | Recombinant Human EZH2(C-term-306aa) fused with His tag was expressed in E. coli. |
Description: | This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene. |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Species: | Human |
Formulation: | The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15%glycerol. |
Tag: | His |
Amino Acid Sequence: | RVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP |
Expression System: | E. coli |
Protein Length: | C-term-306aa |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ] |
Gene ID NCBI: | 2146 |
Official Symbol: | EZH2 |
Synonyms: | EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A; lysine N-methyltransferase 6; ENX1; WVS2; ENX-1; MGC9169; |
mRNA Refseq: | NM_004456 |
Protein Refseq: | NP_004447 |
MIM: | 601573 |
UniProt ID: | Q15910 |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0006 | GSK343 | Inquiry |
BSM-0059 | 3-Deazaneplanocin A | Inquiry |
BSM-0060 | 3-Deazaneplanocin A hydrochloride | Inquiry |
◆ Extracts & Lysates | ||
EL-0024 | Recombinant Human EZH1 293 Cell Lysate | Inquiry |
EL-0025 | Recombinant Human EZH2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
ezh1 | EZH2 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools