Recombinant Human EZH2 Protein, His-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0245
Product Name:  Recombinant Human EZH2 Protein, His-tagged
Product Overview:  Recombinant Human EZH2(C-term-306aa) fused with His tag was expressed in E. coli.
Description:  This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Species:  Human
Formulation:  The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7. ) added with 300mM Imidazole and 15%glycerol.
Tag:  His
Amino Acid Sequence:  RVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
Expression System:  E. coli
Protein Length:  C-term-306aa
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  EZH2 enhancer of zeste homolog 2 (Drosophila) [ Homo sapiens ]
Gene ID NCBI:  2146
Official Symbol:  EZH2
Synonyms:  EZH2; enhancer of zeste homolog 2 (Drosophila); enhancer of zeste (Drosophila) homolog 2; histone-lysine N-methyltransferase EZH2; ENX 1; EZH1; KMT6; KMT6A; lysine N-methyltransferase 6; ENX1; WVS2; ENX-1; MGC9169;
mRNA Refseq:  NM_004456
Protein Refseq:  NP_004447
MIM:  601573
UniProt ID:  Q15910
Product Types
◆ Bioactive Small Molecules
BSM-0006 GSK343 Inquiry
BSM-0059 3-Deazaneplanocin A Inquiry
BSM-0060 3-Deazaneplanocin A hydrochloride Inquiry
◆ Extracts & Lysates
EL-0024 Recombinant Human EZH1 293 Cell Lysate Inquiry
EL-0025 Recombinant Human EZH2 293 Cell Lysate Inquiry
Related Gene / Proteins
ezh1 EZH2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.