| Cat.No.: | PE-0264 |
| Product Name: | Recombinant Human DNMT1 protein, GST-tagged |
| Product Overview: | Recombinant Human DNMT1(1 a.a. - 110 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
| Description: | This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants. |
| Applications: | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 37.84 kDa |
| Species: | Human |
| Formulation: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Tag: | GST |
| Amino Acid Sequence: | MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENG |
| Expression System: | Wheat Germ |
| Protein Length: | 1 a.a. - 110 a.a. |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | DNMT1 DNA (cytosine-5-)-methyltransferase 1 [ Homo sapiens ] |
| Gene ID NCBI: | 1786 |
| Official Symbol: | DNMT1 |
| Synonyms: | DNMT1; DNA (cytosine-5-)-methyltransferase 1; DNMT; DNA (cytosine-5)-methyltransferase 1; CXXC9; MCMT; m.HsaI; DNA MTase HsaI; CXXC finger protein 9; DNA methyltransferase 1; DNA methyltransferase HsaI; CXXC-type zinc finger protein 9; AIM; HSN1E; FLJ16293; MGC104992; |
| mRNA Refseq: | NM_001379 |
| Protein Refseq: | NP_001370 |
| MIM: | 126375 |
| UniProt ID: | P26358 |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0008 | Vinorelbine Tartrate | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0027 | Recombinant Human DNMT3A 293 Cell Lysate | Inquiry |
| EL-0028 | Recombinant Human DNMT3B 293 Cell Lysate | Inquiry |
| EL-0029 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
| EL-0030 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| DNA alkyltransferase | DNAJC2 | DNAS1L1 | DNASE1L3 |
| DNMT | DNMT1 | DNMT2 | DNMT3A |
| DNMT3B | DNMT3L | DNMT4 | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
