| Cat.No.: | PE-0306 |
| Product Name: | Recombinant Human BAZ2A Protein, GST-tagged |
| Product Overview: | Human BAZ2A partial ORF ( NP_038477.1, 1681 a.a. - 1780 a.a.) recombinant protein with GST-tag at N-terminal. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 36.74 kDa |
| Species: | Human |
| Formulation: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Tag: | GST |
| Amino Acid Sequence: | PKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQKRKSGYSLNFSEGDGRRRRVLLKGRESPAAGPRYSEERLSPSKRRRLSMRNHHSDLTFCEIILM |
| Expression System: | Wheat Germ |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | BAZ2A bromodomain adjacent to zinc finger domain, 2A [ Homo sapiens ] |
| Gene ID NCBI: | 11176 |
| Official Symbol: | BAZ2A |
| Synonyms: | BAZ2A; bromodomain adjacent to zinc finger domain, 2A; bromodomain adjacent to zinc finger domain protein 2A; KIAA0314; TIP5; TTF I interacting peptide 5; WALp3; hWALp3; TTF-I interacting peptide 5; TTF-I-interacting protein 5; transcription termination factor I-interacting protein 5; FLJ13768; FLJ13780; FLJ45876; DKFZp781B109; |
| mRNA Refseq: | NM_013449 |
| Protein Refseq: | NP_038477 |
| MIM: | 605682 |
| UniProt ID: | Q9UIF9 |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0024 | Human BAP1 Knockout Cell Line 109bp insertion | Inquiry |
| CL-0030 | Human BAZ1A Knockout Cell Line 11bp deletion | Inquiry |
| CL-0031 | Human BAZ1B Knockout Cell Line 10bp deletion | Inquiry |
| CL-0032 | Human BAZ2A Knockout Cell Line 16bp deletion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0032 | Recombinant Human BAZ2B Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| BAF53A | BAP1 | BAP18 | BARD1 |
| BarX2 | BASP1 | BATZFD | BAZ1A |
| BAZ1B | BAZ2 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
