Cat.No.: | PE-0322 |
Product Name: | Recombinant Human BRD2 |
Product Overview: | FSH Human Recombinant produced in HEK-293 cells is heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH-alpha chain (Met1-Ser116) and human FSH-beta chain (Met1-Glu129) having a total Mw of 38kDa. FSH human recombinant is purified by proprietary chromatographic techniques. |
Description: | This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene. |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Molecular Weight: | 38 kDa |
Purity: | Greater than 95% as determined by SDS-PAGE. |
Species: | Human |
Formulation: | The recombinant FSH was lyophilized from a concentrated (1mg/ml) solution containing PBS. |
Amino Acid Sequence: | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS. FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE. |
Reconstitution: | It is recommended to reconstitute the lyophilized Follicle Stimulating Hormone in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions. |
Activity: | The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml. |
Expression System: | HEK293 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Synthetic Peptides | ||
SP-0001 | Bromodomain Non-Acetylated Ligand 4 | Inquiry |
SP-0002 | Bromodomain Non-Acetylated Ligand 3 | Inquiry |
SP-0003 | Bromodomain Non-Acetylated Ligand 1 | Inquiry |
SP-0004 | Bromodomain Ligand 3 | Inquiry |
SP-0006 | Bromodomain Ligand 4 | Inquiry |
Related Gene / Proteins | |||
BRCA1 | BRCA2 | BRCC3 | BRD |
brd1 | brd2 | brd3 | brd4 |
BRD7 | BRD8 | brd9 | brdt |
BRL | BRM | BRMS1 | BRPF1 |
BRPF2 | brpf3 | BRWD1 | BRWD3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools