| Cat.No.: | PE-0385 |
| Product Name: | Recombinant Human CREBBP protein, His-tagged |
| Product Overview: | Recombinant Human CREBBP(a.a: 1081-1197) fused with His tag at N-terminal was expressed in E. coli. |
| Applications: | Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 14.9 kDa |
| Purity: | > 98% |
| Species: | Human |
| Formulation: | 45 mM Tris-HCl, pH 8.0, 124 mM NaCl, 2.4 mM KCl, and 10% glycerol |
| Tag: | His |
| Amino Acid Sequence: | MHHHHHHRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQY QEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG |
| Expression System: | E. coli |
| Concentrations: | 1.26 mg/ml |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | CREBBP CREB binding protein [ Homo sapiens ] |
| Gene ID NCBI: | 1387 |
| Official Symbol: | CREBBP |
| Synonyms: | CREBBP; CREB binding protein; RSTS, Rubinstein Taybi syndrome; CREB-binding protein; CBP; KAT3A; RTS; RSTS; |
| mRNA Refseq: | NM_004380 |
| Protein Refseq: | NP_004371 |
| MIM: | 600140 |
| UniProt ID: | Q92793 |
| Chromosome Location: | 16p13.3 |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0055 | Human CREBBP Knockout Cell Line 1bp insertion | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0094 | C646 | Inquiry |
| BSM-0124 | EML-425 | Inquiry |
| BSM-0150 | I-CBP112 (Hydrochloride) | Inquiry |
| ◆ Research Kits | ||
| EKIT-0122 | CBP bromodomain TR-FRET Assay Kit | Inquiry |
| Related Gene / Proteins | |||
| CREB | CREB3 | crebbp | CRISP1 |
| CRISP3 | CRP | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
