Recombinant Human SP2


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0724
Product Name:  Recombinant Human SP2
Product Overview:  Recombinant full length Human SP2 transcription factor with N terminal proprietary tag; Predicted MW 53.46 kDa.
Description:  This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters.
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  53.460kDa inclusive of tags
Species:  Human
Amino Acid Sequence:  MAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGP PAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPGKNSFGIL SSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSN ANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAII TPSPSSHKPVPIKPAPIQKSSTTTTPVQSGANVVKLTGGG GNVTLTLPVNNLVNASDTGAPTQLLTASCQTGMLNSTRMF LFLAFINVL
Sequence Similarities:  Belongs to the Sp1 C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.
Expression System:  Wheat germ
Protein Length:  249 amino acids
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  SP2 Sp2 transcription factor [ Homo sapiens ]
Gene ID NCBI:  6668
Official Symbol:  SP2
Synonyms:  SP2; Sp2 transcription factor; transcription factor Sp2; KIAA0048;
mRNA Refseq:  NM_003110
Protein Refseq:  NP_003101
MIM:  601801
UniProt ID:  Q02086
Chromosome Location:  17q21.3-q22
Function:  DNA binding; histone deacetylase binding; metal ion binding; zinc ion binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.