| Cat.No.: | PE-0777 |
| Product Name: | Recombinant Human SET |
| Product Overview: | Recombinant full length Human SET isoform 2 with N terminal proprietary tag, 55.88kDa. |
| Description: | The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene. |
| Tissue Specificity: | Widely expressed. Low levels in quiescent cells during serum starvation, contact inhibition or differentiation. Highly expressed in Wilms tumor. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 55.880kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQN EIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPN FWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKS GYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKW KSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAG ADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDE EEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD |
| Sequence Similarities: | Belongs to the nucleosome assembly protein (NAP) family. |
| Expression System: | Wheat germ |
| Protein Length: | 277 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SET SET nuclear oncogene [ Homo sapiens ] |
| Gene ID NCBI: | 6418 |
| Official Symbol: | SET |
| Synonyms: | SET; SET nuclear oncogene; SET translocation (myeloid leukemia associated); protein SET; 2PP2A; IPP2A2; PHAPII; protein phosphatase type 2A inhibitor; Template Activating Factor I; chromatin remodelling factor; |
| mRNA Refseq: | NM_001122821 |
| Protein Refseq: | NP_001116293 |
| MIM: | 600960 |
| UniProt ID: | Q01105 |
| Chromosome Location: | 9q34 |
| Function: | histone binding; protein binding; protein phosphatase inhibitor activity; protein phosphatase type 2A regulator activity; |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| ◆ Antibodies | ||
| EAb-0030 | SETD8 Polyclonal Antibody | Inquiry |
| EAb-0031 | SETDB1 Polyclonal Antibody | Inquiry |
| EAb-0032 | Setd1a Polyclonal Antibody | Inquiry |
| EAb-0033 | Setd1b Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| SENP3 | SENP8 | SET | SET1 |
| SET2 | SET7 | SET8 | SET9 |
| SETBP1 | SETD1A | SETD1B | SETD2 |
| SETD3 | SETD5 | SETD6 | SETD7 |
| SETD8 | SETD9 | SetDB1 | SETDB2 More > |
| SETMAR | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
