Recombinant Human TRIM24 protein, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-0879
Product Name:  Recombinant Human TRIM24 protein, GST-tagged
Product Overview:  Recombinant Human TRIM24(432 a.a. - 569 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description:  The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Applications:  Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  40.81 kDa
Species:  Human
Formulation:  50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Tag:  GST
Amino Acid Sequence:  PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPS ISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW
Expression System:  Wheat Germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  TRIM24 tripartite motif containing 24 [ Homo sapiens ]
Gene ID NCBI:  8805
Official Symbol:  TRIM24
Synonyms:  TRIM24; tripartite motif containing 24; TIF1, transcriptional intermediary factor 1 , tripartite motif containing 24; transcription intermediary factor 1-alpha; hTIF1; RNF82; TIF1A; Tif1a; TIF1-alpha; RING finger protein 82; tripartite motif-containing 24; E3 ubiquitin-protein ligase TRIM24; transcriptional intermediary factor 1; PTC6; TF1A; TIF1; TIF1ALPHA;
mRNA Refseq:  NM_015905
Protein Refseq:  NP_056989
MIM:  603406
UniProt ID:  O15164
Chromosome Location:  7q32-q34
Function:  chromatin binding; estrogen response element binding; histone acetyl-lysine binding; ligand-dependent nuclear receptor binding; ligase activity; metal ion binding; NOT methylated histone residue binding; p53 binding; protein binding; protein kinase activity; receptor binding; sequence-specific DNA binding; transcription coactivator activity; ubiquitin-protein ligase activity; zinc ion binding;

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.