| Cat.No.: | PE-1013 |
| Product Name: | Recombinant Human H2AFY2, His-tagged |
| Product Overview: | Recombinant fragment, corresponding to amino acids 164-372 of Human Macro H2A.2 with an N terminal His tag. Observed mwt: 27 kDa ; |
| Description: | Chromatin of the inactive X chromosome (Xi) in female mammals is enriched for the core histone variant macroH2A. MacroH2A is evenly distributed throughout the male nucleus, while in female nuclei macroH2A additionally is enriched on chromatin of the Xi, and forms a structure referred to as a macro chromatin body (MCB) that is coincident with the Barr body. X-inactivation studies in differentiating female mouse embryonic stem cells demonstrate that macroH2A relocates from a centrosomal accumulation in the cytoplasm to chromatin of the Xi after the initial stages of X-inactivation have occurred. The cellular distribution of macroH2A during the cell cycle in synchronized cultured human female somatic cells has been determined. As the cells approach mitosis, the MCB (as detected by indirect immunofluorescence using anti-macroH2A antibodies) decreases dramatically in size to a small chromatic body (SCB). Interestingly, as the MCB shrinks in size, macroH2A begins to accumulate at the centrosome. During mitosis, macroH2A remains associated with specific regions of the Xi, with the most enrichment at Xq22-25. After mitosis, the levels of macroH2A at the centrosome decrease as the MCB reforms at the Xi. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitute with 78 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | DSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSD ISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEF LETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRN CFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSE SIGIYVQEMAKLDAK |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | H2AFY2 H2A histone family, member Y2 [ Homo sapiens ] |
| Gene ID NCBI: | 55506 |
| Official Symbol: | H2AFY2 |
| Synonyms: | H2AFY2; H2A histone family, member Y2; core histone macro-H2A.2; macroH2A2; |
| mRNA Refseq: | NM_018649 |
| Protein Refseq: | NP_061119 |
| UniProt ID: | Q9P0M6 |
| Chromosome Location: | 10q22.1 |
| Function: | DNA binding; |
| Product Types | ||
| ◆ Nucleosomes | ||
| NUC-0007 | Recombinant Tetranucleosomes H3.3 | Inquiry |
| NUC-0008 | Recombinant Mononucleosomes H3.3 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0009 | Histone H4 peptide (1-21), Biotin-labeled | Inquiry |
| SP-0010 | Histone H4 peptide (1-21) | Inquiry |
| SP-0012 | Histone H3 peptide (21-44), Biotin-labeled | Inquiry |
| Related Gene / Proteins | |||
| HIC1 | HIF1A | HIF1AN | HINFP |
| HIPK1 | HIPK2 | HIRA | Histone |
| Histone H1 | Histone H2A | Histone H2B | Histone H3 |
| Histone H4 | HIV-1 reverse transcriptase | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
