Recombinant Human ARID4A protein, GST-tagged


  • Specification
  • Gene Information
  • Related Products
Cat.No.:  PE-1219
Product Name:  Recombinant Human ARID4A protein, GST-tagged
Product Overview:  Human ARID4A partial ORF ( NP_002883, 1033 a.a. - 1139 a.a.) recombinant protein with GST-tag at N-terminal.
Description:  The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein (pRB) which regulates cell proliferation. pRB represses transcription by recruiting the encoded protein. This protein, in turn, serves as a bridging molecule to recruit HDACs and, in addition, provides a second HDAC-independent repression function. The encoded protein possesses transcriptional repression activity. Multiple alternatively spliced transcripts have been observed for this gene, although not all transcript variants have been fully described. [provided by RefSeq, Jul 2008]
Applications:  Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  37.51 kDa
Species:  Human
Tag:  GST
Amino Acid Sequence:  AEESQEGLCERESANGFETNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLAR
Expression System:  Wheat Germ
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Gene Name:  ARID4A AT rich interactive domain 4A (RBP1-like) [ Homo sapiens ]
Gene ID NCBI:  5926
Official Symbol:  ARID4A
Synonyms:  ARID4A; AT rich interactive domain 4A (RBP1-like); RBBP1, retinoblastoma binding protein 1; AT-rich interactive domain-containing protein 4A; RBP 1; RBP1; retinoblastoma binding protein 1; retinoblastoma-binding protein 1; ARID domain-containing protein 4A; RBBP1; RBP-1; RBBP-1;
mRNA Refseq:  NM_002892
Protein Refseq:  NP_002883
MIM:  180201
UniProt ID:  P29374

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.