| Cat.No.: | PE-1230 |
| Product Name: | Recombinant Human ASH2L protein, GST-tagged |
| Product Overview: | Human ASH2L full-length ORF ( AAH15936.1, 1 a.a. - 534 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description: | ASH2L (ASH2 Like Histone Lysine Methyltransferase Complex Subunit) is a Protein Coding gene. Diseases associated with ASH2L include Kabuki Syndrome 1. Among its related pathways are Signaling by Wnt and Chromatin organization. GO annotations related to this gene include transcription regulatory region DNA binding and histone methyltransferase activity (H3-K4 specific). |
| Applications: | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Molecular Weight: | 86.6 kDa |
| Species: | Human |
| Tag: | GST |
| Amino Acid Sequence: | MDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP |
| Expression System: | Wheat Germ |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | ASH2L ash2 (absent, small, or homeotic)-like (Drosophila) [ Homo sapiens ] |
| Gene ID NCBI: | 9070 |
| Official Symbol: | ASH2L |
| Synonyms: | ASH2L; ash2 (absent, small, or homeotic)-like (Drosophila); ash2 (absent, small, or homeotic, Drosophila, homolog) like , ASH2L1; set1/Ash2 histone methyltransferase complex subunit ASH2; ASH2; ASH2L2; Bre2; ASH2-like protein; ASH2L1; |
| mRNA Refseq: | NM_001105214 |
| Protein Refseq: | NP_001098684 |
| MIM: | 604782 |
| UniProt ID: | Q9UBL3 |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0018 | Human ASH1L Knockout Cell Line 53bp deletion | Inquiry |
| CL-0019 | Human ASXL2 Knockout Cell Line 1bp insertion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0162 | Recombinant Human ASH2L 293 Cell Lysate | Inquiry |
| EL-0173 | Recombinant Human ASF1A 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0168 | ASH2 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| ASB10 | ASB11 | ASB13 | ASB6 |
| ASB7 | ASB8 | ASB9 | ASF1 |
| ASH1L | ASH2 | ASXL2 | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
