| Cat.No.: | PE-1326 |
| Product Name: | Recombinant Human ING5, His-tagged |
| Product Overview: | Recombinant fragment, corresponding to amino acids 2-240 of Human ING5 with N terminal His tag; 239 amino acids, kDa. |
| Description: | The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in TP53-dependent regulatory pathway. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitute with 71 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | ATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAE IDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYS DDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKK HKGGSEFTDTILSVHPSDVLDMPVDPNEPTYCLCHQVS YGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | ING5 inhibitor of growth family, member 5 [ Homo sapiens ] |
| Gene ID NCBI: | 84289 |
| Official Symbol: | ING5 |
| Synonyms: | ING5; inhibitor of growth family, member 5; inhibitor of growth protein 5; FLJ23842; p28ING5; |
| mRNA Refseq: | NM_032329 |
| Protein Refseq: | NP_115705 |
| MIM: | 608525 |
| UniProt ID: | Q8WYH8 |
| Chromosome Location: | 2q37.3 |
| Function: | metal ion binding; methylated histone residue binding; protein binding; zinc ion binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0182 | Recombinant Human ING5 293 Cell Lysate | Inquiry |
| EL-0189 | Recombinant Human ING3 293 Cell Lysate | Inquiry |
| EL-0196 | Recombinant Human ING4 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0317 | ING4 Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0403 | Human INSL6 Knockout Cell Line | Inquiry |
| Related Gene / Proteins | |||
| ING1 | ING2 | ING3 | ING4 |
| ING5 | INHAT-1 | INHAT-2 | Ini1 |
| INSL6 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
