| Cat.No.: | PE-1419 |
| Product Name: | Recombinant Human CTCFL |
| Product Overview: | Recombinant fragment corresponding to amino acids 193-293 of Human BORIS with a proprietary tag at N-terminal; Predicted MWt 36.74 kDa. |
| Description: | CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation. This gene is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes, unlike CTCF which is expressed primarily in the nucleus of somatic cells. CTCF and the protein encoded by this gene are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation. |
| Tissue Specificity: | Testis specific. Specifically expressed in primary spermatocytes. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36.740kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | AERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKT |
| Sequence Similarities: | Belongs to the CTCF zinc-finger protein family.Contains 11 C2H2-type zinc fingers. |
| Expression System: | Wheat germ |
| Protein Length: | 101 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | CTCFL CCCTC-binding factor (zinc finger protein)-like [ Homo sapiens ] |
| Gene ID NCBI: | 140690 |
| Official Symbol: | CTCFL |
| Synonyms: | CTCFL; CCCTC-binding factor (zinc finger protein)-like; transcriptional repressor CTCFL; BORIS; cancer/testis antigen 27; CT27; dJ579F20.2; |
| mRNA Refseq: | NM_080618 |
| Protein Refseq: | NP_542185 |
| MIM: | 607022 |
| UniProt ID: | Q8NI51 |
| Chromosome Location: | 20q13.31 |
| Function: | DNA binding; histone binding; metal ion binding; protein binding; sequence-specific DNA binding; |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0168 | Human CTDSP1 Knockout Cell Line 26bp deletion | Inquiry |
| CL-0195 | Human CTDSPL Knockout Cell Line 1bp insertion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0169 | Recombinant Human CTSL1 Cell Lysate | Inquiry |
| EL-0204 | Recombinant Human CTCFL 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0849 | CTCF Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| CTBP | CTBP2 | CTCF | CTCFL |
| CTDSP1 | CTDSPL | CtIP | ctnnb1 |
| CTSL1 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
