Cat.No.: | PE-1519 |
Product Name: | Recombinant Human JARID2 |
Product Overview: | Recombinant fragment corresponding to amino acids 1130-1229 of Human Jarid2 with a proprietary tag at N-terminal predicted MWt 37 kDa |
Description: | This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a DNA-binding domain, called an AT-rich interaction domain (ARID), and share regions of similarity with human retinoblastoma-binding protein-2 and the human SMCX protein. |
Tissue Specificity: | During embryogenesis, predominantly expressed in neurons and particularly in dorsal root ganglion cells. |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 37.000kDa |
Species: | Human |
Amino Acid Sequence: | LQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDVP |
Sequence Similarities: | Contains 1 ARID domain.Contains 1 JmjC domain.Contains 1 JmjN domain. |
Expression System: | Wheat germ |
Protein Length: | 100 amino acids |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Gene Name: | JARID2 jumonji, AT rich interactive domain 2 [ Homo sapiens ] |
Gene ID NCBI: | 3720 |
Official Symbol: | JARID2 |
Synonyms: | JARID2; jumonji, AT rich interactive domain 2; JMJ, jumonji (mouse) homolog , Jumonji, AT rich interactive domain 2; protein Jumonji; |
mRNA Refseq: | NM_004973 |
Protein Refseq: | NP_004964 |
MIM: | 601594 |
UniProt ID: | Q92833 |
Chromosome Location: | 6p24-p23 |
Function: | DNA binding; chromatin binding; NOT histone demethylase activity; |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0002 | AT9283 | Inquiry |
◆ Cell Lines | ||
CL-0017 | Human JARID2 Knockout Cell Line 11bp deletion | Inquiry |
◆ Antibodies | ||
EAb-0079 | JARID2 Polyclonal Antibody | Inquiry |
EAb-0080 | JARID1C Polyclonal Antibody | Inquiry |
EAb-0081 | JARID1B Polyclonal Antibody | Inquiry |
Related Gene / Proteins | |||
JADE1 | JAK | JAK1 | JAK2 |
JAK3 | JAKMIP1 | JARID | JARID1 |
JARID1A | JARID1B | JARID1C | JARID2 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools