Recombinant human KDM4C / GASC1 / JMJD2C protein (Tagged)


  • Specification
  • Related Products
Cat.No.:  PE-2053
Product Name:  Recombinant human KDM4C / GASC1 / JMJD2C protein (Tagged)
Background:  Histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-20'. Demethylates trimethylated H3 'Lys-9' and H3 'Lys-36' residue, while it has no activity on mono- and dimethylated residues. Demethylation of Lys residue generates formaldehyde and succinate.
Applications:  Functional Studies; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  69 kDa including tags
Purity:  >82 % SDS-PAGE.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol, 0.49% Glutathione
Accession#:  Q9H3R0
Alternative Names:  bA146B14.1/GASC 1 protein/GASC-1 protein
Tag:  GST
Amino Acid Sequence:  EVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIP PKEWKPRQCYDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQ LANSGKYCTPRYLDYEDLERKYWKNLTFVAPIYGADINGSIYDEGVDEWN IARLNTVLDVVEEECGISIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINY LHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSV LKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWIDY GKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPA STPEVKAWLQRRRKVRKASRS
Sequence Similarities:  Belongs to the JHDM3 histone demethylase family.Contains 1 JmjC domain.Contains 1 JmjN domain.Contains 2 PHD-type zinc fingers.Contains 2 Tudor domains.
Expression System:  Sf9 Insect Cells
Protein Length:  Protein fragment; 2 to 372
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.