Recombinant Human KDM4A / JHDM3A / JMJD2A protein (Tagged)


  • Specification
  • Related Products
Cat.No.:  PE-2197
Product Name:  Recombinant Human KDM4A / JHDM3A / JMJD2A protein (Tagged)
Background:  Histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-20'. Demethylates trimethylated H3 'Lys-9' and H3 'Lys-36' residue, while it has no activity on mono- and dimethylated residues. Demethylation of Lys residue generates formaldehyde and succinate. Participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively.Isoform 2: Crucial for muscle differentiation, promotes transcriptional activation of the Myog gene by directing the removal of repressive chromatin marks at its promoter. Lacks the N-terminal demethylase domain.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  42 kDa including tags
Purity:  > 90 % SDS-PAGE.
Species:  Human
Accession#:  O75164
Alternative Names:  JHDM3A/JmjC domain containing histone demethylation protein 3A/JmjC domain-containing histone demethylation protein 3A
Amino Acid Sequence:  NLERAKGALQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSF SDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQ VEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSVASD
Sequence Similarities:  Belongs to the JHDM3 histone demethylase family.Contains 1 C2HC pre-PHD-type zinc finger.Contains 1 JmjC domain.Contains 1 JmjN domain.Contains 2 PHD-type zinc fingers.Contains 2 Tudor domains.
Expression System:  E. coli
Post Translational Modifications:  Ubiquitinated by RNF8 and RNF168 following DNA damage, leading to its degradation. Degradation promotes accessibility of H4K20me2 mark for DNA repair protein TP53BP1, which is then recruited.
Protein Length:  Protein fragment; 888 to 1023
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.