| Cat.No.: | PE-2219 |
| Product Name: | Recombinant Human CDA protein |
| Background: | CDA (Cytidine deaminase) scavengers exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis. Growth inhibition of granulocyte-macrophage colony foring cells by human cytidine deaminase requires the catalytic function of the protein. It is highly expressed in granulocytes. |
| Applications: | SDS-PAGE; Mass Spectrometry |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 18 kDa including tags |
| Purity: | > 90 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 0.0584% EDTA, 40% Glycerol, 0.58% Sodium chloride |
| Accession#: | P32320 |
| Alternative Names: | CDD/Cytidine aminohydrolase/Cytidine deaminase |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMAQKRPACTLKPECVQQLLVCSQEAKQSAY CPYSHFPVGAALLTQEGRIFKGCNIENACYPLGICAERTAIQKAVSEGYK DFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQ ELLPSSFGPEDLQKTQ |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 146 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0112 | Human CDKN1B Knockout Cell Line 10bp deletion | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0118 | Recombinant Mouse CDK1 Cell Lysate | Inquiry |
| EL-0119 | Recombinant Human CDK1 Cell Lysate | Inquiry |
| EL-0209 | Recombinant Human CD1D & B2M Cell Lysate | Inquiry |
| EL-0210 | Recombinant Human CD1D Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| CD1D | CDA | CDC34 | CDK1 |
| CDK8 | CDK9 | CDKA1 | CDKN1B |
| CDX1 | CDY2A | CDYL | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
