| Cat.No.: | PE-2259 |
| Product Name: | Recombinant Human SUN1 protein |
| Background: | Component of SUN-protein-containing multivariate complexes also called LINC complexes which link the nucleoskeleton and cytoskeleton by providing versatile outer nuclear membrane attachment sites for cytoskeletal filaments. Required for interkinetic nuclear migration (INM) and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration. Anchors chromosome movement in the prophase of meiosis and is involved in selective gene expression of coding and non-coding RNAs needed for gametogenesis. Required for telomere attachment to nuclear envelope and gametogenesis. Helps to define the distribution of nuclear pore complexes (NPCs). |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Protein unc-84 homolog A/Sad1 and UNC84 domain containing 1/Sad1/unc 84 protein like 1 |
| Tag: | GST |
| Amino Acid Sequence: | MDFSRLHMYSPPQCVPENTGYTYALSSSYSSDALDFETEHKLDPVFDSPR MSRRSLRLATTACTLGDGEAVGADSGTSSAVSLKNRAARTTKQRRSTNKS AFSINHVSRQVTSSGVSHGGTVSLQDAVTRRPPVLDESWIREQTTVDHFW GLDDDGDLKGGSKAAIQGNGDVGAAAATAHNGFSCSNCSMLSERKDVLTA HPAPPGPVSRVYSRDRNQKCKSQSFKTQKKVCFPNLIFPFCKSQCLHYLS WRLKIIP |
| Sequence Similarities: | Contains 1 SUN domain. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 257 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0020 | Suz12 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0100 | Chaetocin | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0103 | Recombinant Human SUZ12 293 Cell Lysate | Inquiry |
| EL-0132 | Recombinant Human SUV39H1 293 Cell Lysate | Inquiry |
| EL-0137 | Recombinant Human SUV420H1 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| SUDS3 | SUMO | SUMO1 | SUMO2 |
| SUMO3 | SUN1 | Surf6 | suv39h1 |
| SUV39H2 | SUV3L1 | SUV420H1 | SUV420H2 |
| SUZ12 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
