| Cat.No.: | PE-2320 |
| Product Name: | Recombinant Human GTF3C4 protein |
| Background: | Essential for RNA polymerase III to make a number of small nuclear and cytoplasmic RNAs, including 5S RNA, tRNA, and adenovirus-associated (VA) RNA of both cellular and viral origin. Has histone acetyltransferase activity (HAT) with unique specificity for free and nucleosomal H3. May cooperate with GTF3C5 in facilitating the recruitment of TFIIIB and RNA polymerase through direct interactions with BRF1, POLR3C and POLR3F. May be localized close to the A box. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | EC 2.3.1.48/FLJ21002/General transcription factor 3C 4 |
| Tag: | GST |
| Amino Acid Sequence: | DDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLR CFLTYQSCQSLIYRRCLLHDSIARHPAPEDPDWIKRLLQSPCPFCDSPVF |
| Sequence Similarities: | Belongs to the TFIIIC subunit 4 family. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 723 to 822 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Proteins & Enzymes | ||
| PE-2320 | Recombinant Human GTF3C4 protein | Inquiry |
| PE-2511 | Recombinant Human GTF2IRD1 protein | Inquiry |
| PE-2512 | Recombinant Human GTF2IRD1 protein | Inquiry |
| PE-2513 | Recombinant Human GTF2IRD1 protein | Inquiry |
| Related Gene / Proteins | |||
| GTF2IRD1 | GTF3C4 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
