| Cat.No.: | PE-2321 |
| Product Name: | Recombinant Human GRC5 / PHF2 protein |
| Background: | Lysine demethylase that demethylates both histones and non-histone proteins. Enzymatically inactive by itself, and becomes active following phosphorylation by PKA: forms a complex with ARID5B and mediates demethylation of methylated ARID5B. Demethylation of ARID5B leads to target the PHF2-ARID5B complex to target promoters, where PHF2 mediates demethylation of dimethylated 'Lys-9' of histone H3 (H3K9me2), followed by transcription activation of target genes. The PHF2-ARID5B complex acts as a coactivator of HNF4A in liver. PHF2 is recruited to trimethylated 'Lys-4' of histone H3 (H3K4me3) at rDNA promoters and promotes expression of rDNA. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | CENP-35/GRC5/JHDM1E |
| Tag: | GST |
| Amino Acid Sequence: | ATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCP NCEKTHGKSTLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPS |
| Sequence Similarities: | Belongs to the JHDM1 histone demethylase family. JHDM1D subfamily.Contains 1 JmjC domain.Contains 1 PHD-type zinc finger. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylated by PKA on specific serine residues, leading to the formation of an active lysine demethylase complex. |
| Protein Length: | Protein fragment; 2 to 100 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0056 | PHF8 Polyclonal Antibody | Inquiry |
| EAb-0058 | PHC2 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0114 | DMOG | Inquiry |
| ◆ Cell Lines | ||
| CL-0115 | Human PHF6 Knockout Cell Line 1bp deletion | Inquiry |
| CL-0116 | Human PHIP Knockout Cell Line 2bp deletion | Inquiry |
| Related Gene / Proteins | |||
| GRC5 | PHB | PHC1 | PHC2 |
| PHD | PHD1 | PHD2 | PHD3 |
| PHF1 | PHF10 | PHF13 | PHF17 |
| PHF2 | PHF20 | PHF20B | PHF21A |
| PHF21B | PHF6 | PHF8 | PHIP More > |
| PHPT1 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
