Cat.No.: | PE-2378 |
Product Name: | Recombinant Human GPS2 protein |
Background: | GPS2(G-protein pathway suppressor 2), also called AMF1, is a human nuclear protein of 327 amino acids involved in G protein-mitogen-activated protein kinase(MAPK) signalling cascades. This protein is an integral subunit of the NCOR1-HDAC3(nuclear receptor corepressor 1-histone deacetylase 3) complex which inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1(activator protein 1) function. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | AMF 1/AMF1/G protein pathway suppressor 2 |
Tag: | GST |
Amino Acid Sequence: | QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQ ALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 228 to 327 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Cell Lines | ||
CL-0183 | Human GPRASP1 Knockout Cell Line | Inquiry |
◆ Proteins & Enzymes | ||
PE-2378 | Recombinant Human GPS2 protein | Inquiry |
PE-2514 | Recombinant Human GPATCH3 protein | Inquiry |
PE-2515 | Recombinant Human GPATCH2 protein | Inquiry |
PE-2958 | Recombinant Human XAB1/GPN1 protein | Inquiry |
Related Gene / Proteins | |||
GPATCH2 | GPATCH3 | GPN1 | GPRASP1 |
GPS2 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools