| Cat.No.: | PE-2388 |
| Product Name: | Recombinant Human EID1 protein |
| Background: | Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellular differentiation. May act as a candidate coinhibitory factor for NR0B2 that can be directly linked to transcription inhibitory mechanisms. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | 21 kDa pRb associated protein/21 kDa pRb-associated protein/C15orf3 |
| Tag: | GST |
| Amino Acid Sequence: | QLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEEL FSLMVVNRLTEELGCDEIIDRE |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Ubiquitinated in U-2OS osteosarcoma cells and is rapidly degraded by proteasome as cells exit the cell cycle exit. |
| Protein Length: | Protein fragment; 116 to 187 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Proteins & Enzymes | ||
| PE-2388 | Recombinant Human EID1 protein | Inquiry |
| PE-2389 | Recombinant Human EID1 protein | Inquiry |
| PE-3474 | Recombinant EIF4A3 protein | Inquiry |
| PE-3475 | Recombinant EIF4A2 protein | Inquiry |
| PE-3476 | Recombinant EIF4A1 protein | Inquiry |
| Related Gene / Proteins | |||
| EID1 | EIF4A1 | EIF4A2 | EIF4A3 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
