| Cat.No.: | PE-2392 |
| Product Name: | Recombinant Human DMAP1 protein |
| Background: | DMAP1 is involved in transcription repression and activation. Its interaction with HDAC2 may provide a mechanism for histone deacetylation in heterochromatin following replication of DNA at late firing origins. Can also repress transcription independently of histone deacetylase activity. May specifically potentiate DAXX-mediated repression of glucocorticoid receptor-dependent transcription. Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | DKFZp686L09142/DMAP 1/DNA methyltransferase 1 associated protein 1 |
| Tag: | GST |
| Amino Acid Sequence: | MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRP EGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 1 to 100 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0147 | DMAP1 Polyclonal Antibody | Inquiry |
| EAb-2114 | DMAP1 Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2392 | Recombinant Human DMAP1 protein | Inquiry |
| Related Gene / Proteins | |||
| DMAP1 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
