Recombinant Human PARK7/DJ1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2454
Product Name:  Recombinant Human PARK7/DJ1 protein
Background:  Protects cells against oxidative stress and cell death. Plays a role in regulating expression or stability of the mitochondrial uncoupling proteins SLC25A14 and SLC25A27 in dopaminergic neurons of the substantia nigra pars compacta and attenuates the oxidative stress induced by calcium entry into the neurons via L-type channels during pacemaking. Eliminates hydrogen peroxide and protects cells against hydrogen peroxide-induced cell death. May act as an atypical peroxiredoxin-like peroxidase that scavenges hydrogen peroxide. Following removal of a C-terminal peptide, displays protease activity and enhanced cytoprotective action against oxidative stress-induced apoptosis. Stabilizes NFE2L2 by preventing its association with KEAP1 and its subsequent ubiquitination. Binds to OTUD7B and inhibits its deubiquitinating activity. Enhances RELA nuclear translocation. Binds to a number of mRNAs containing multiple copies of GG or CC motifs and partially inhibits their translation but dissociates following oxidative stress. Required for correct mitochondrial morphology and function and for autophagy of dysfunctional mitochondria. Regulates astrocyte inflammatory responses. Acts as a positive regulator of androgen receptor-dependent transcription. Prevents aggregation of SNCA. Plays a role in fertilization. Has no proteolytic activity. Has cell-growth promoting activity and transforming activity. May function as a redox-sensitive chaperone.
Applications:  Western blot; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  22 kDa including tags
Purity:  > 85 % SDS-PAGE.
Species:  Human
Formulation:  pH: 7.00; Preservative: 1.02% Imidazole; Constituents: 0.002% PMSF, 0.7% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.76% Sodium chloride
Accession#:  Q99497
Alternative Names:  CAP1/DJ-1/DJ1
Tag:  His
Amino Acid Sequence:  TVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYD VVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIG FGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAI VEALNGKEVAAQVKAPLVLKD
Sequence Similarities:  Belongs to the peptidase C56 family.
Expression System:  E. coli
Post Translational Modifications:  Sumoylated on Lys-130 by PIAS2 or PIAS4; which is enhanced after ultraviolet irradiation and essential for cell-growth promoting activity and transforming activity.Cys-106 is easily oxidized to sulfinic acid.Undergoes cleavage of a C-terminal peptide and subsequent activation of protease activity in response to oxidative stress.
Protein Length:  Protein fragment; 19 to 189
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.