Cat.No.: | PE-2502 |
Product Name: | Recombinant Human Homez protein |
Background: | Homez and members of ZHX family of zinc finger homeodomain factors are delineated as a subset within the superfamily of homeobox-containing proteins. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | Homeobox and leucine zipper protein Homez/Homeodomain leucine zipper containing factor/KIAA1443 |
Tag: | GST |
Amino Acid Sequence: | FGDTRYALKHGQLKWFRDNAVPGAPSFQDPAIPTPPPSTRSLNERAETPP LPIPPPPPDIQPLERYWAAHQQLRETDIPQLSQASRLSTQQVLDWFDSRL PQPAEVVVC |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 380 to 488 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0082 | Recombinant Human HOXA10 293 Cell Lysate | Inquiry |
◆ Antibodies | ||
EAb-0187 | HOXD13 Polyclonal Antibody | Inquiry |
EAb-1961 | HOXA9 Polyclonal Antibody | Inquiry |
◆ Proteins & Enzymes | ||
PE-0680 | Recombinant Mouse HOXA10 Protein | Inquiry |
PE-2502 | Recombinant Human Homez protein | Inquiry |
Related Gene / Proteins | |||
Homez | HOXA10 | HOXA9 | HOXD13 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools