| Cat.No.: | PE-2502 |
| Product Name: | Recombinant Human Homez protein |
| Background: | Homez and members of ZHX family of zinc finger homeodomain factors are delineated as a subset within the superfamily of homeobox-containing proteins. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Homeobox and leucine zipper protein Homez/Homeodomain leucine zipper containing factor/KIAA1443 |
| Tag: | GST |
| Amino Acid Sequence: | FGDTRYALKHGQLKWFRDNAVPGAPSFQDPAIPTPPPSTRSLNERAETPP LPIPPPPPDIQPLERYWAAHQQLRETDIPQLSQASRLSTQQVLDWFDSRL PQPAEVVVC |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 380 to 488 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0082 | Recombinant Human HOXA10 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0187 | HOXD13 Polyclonal Antibody | Inquiry |
| EAb-1961 | HOXA9 Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0680 | Recombinant Mouse HOXA10 Protein | Inquiry |
| PE-2502 | Recombinant Human Homez protein | Inquiry |
| Related Gene / Proteins | |||
| Homez | HOXA10 | HOXA9 | HOXD13 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
