Cat.No.: | PE-2542 |
Product Name: | Recombinant Human DAZAP1 protein |
Background: | RNA-binding protein, which may be required during spermatogenesis. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | DAZ associated protein 1/DAZ-associated protein 1/Dazap1 |
Tag: | GST |
Amino Acid Sequence: | GVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLS GFGQGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR |
Sequence Similarities: | Contains 2 RRM (RNA recognition motif) domains. |
Expression System: | Wheat germ |
Post Translational Modifications: | Phosphorylated upon DNA damage, probably by ATM or ATR. |
Protein Length: | Protein fragment; 308 to 407 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Cell Lines | ||
CL-0165 | Human DAND5 Knockout Cell Line | Inquiry |
◆ Antibodies | ||
EAb-2023 | DAX-1 / NR0B1 Monoclonal Antibody | Inquiry |
◆ Proteins & Enzymes | ||
PE-2534 | Recombinant Human Deleted in azoospermia 4 protein | Inquiry |
PE-2542 | Recombinant Human DAZAP1 protein | Inquiry |
PE-2543 | Recombinant Human DAZAP1 protein | Inquiry |
Related Gene / Proteins | |||
DAI | DAND5 | DAX-1 | Daxx |
DAZ1 | DAZ3 | DAZ4 | DAZAP1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools