Recombinant Human CSDC2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2547
Product Name:  Recombinant Human CSDC2 protein
Background:  RNA-binding factor which binds specifically to the very 3'-UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. Might play a central role in the negative regulation of histone variant synthesis in the developing brain.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  Cold shock domain containing C2 RNA binding/Cold shock domain containing protein C2/Cold shock domain-containing protein C2
Tag:  GST
Amino Acid Sequence:  MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP TKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSD IEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQV VGS
Sequence Similarities:  Contains 1 CSD (cold-shock) domain.
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 153
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.