Cat.No.: | PE-2557 |
Product Name: | Recombinant Human C1D protein |
Background: | Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB. |
Applications: | ELISA; Western blot |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | 1110036E10Rik/AI875855/C1D |
Tag: | GST |
Amino Acid Sequence: | NPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPK SKNASKVANKGKSKS |
Sequence Similarities: | Belongs to the C1D family. |
Expression System: | Wheat germ |
Post Translational Modifications: | Phosphorylated by PRKDC. |
Protein Length: | Protein fragment; 77 to 141 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Cell Lines | ||
CL-0028 | Human C17orf49 Knockout Cell Line | Inquiry |
◆ Antibodies | ||
EAb-2048 | C17orf96 Polyclonal Antibody | Inquiry |
EAb-2049 | C17orf96 phospho Ser15 Polyclonal Antibody | Inquiry |
◆ Proteins & Enzymes | ||
PE-2349 | Recombinant Human C14orf169 / NO66 protein | Inquiry |
PE-2557 | Recombinant Human C1D protein | Inquiry |
Related Gene / Proteins | |||
C14orf169 | C14ORF21 | C17orf42 | C17orf49 |
C17orf96 | C1D |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools