| Cat.No.: | PE-2571 |
| Product Name: | Recombinant Human AKNA protein |
| Background: | AKNA is a transcription factor that specifically activates the expression of the CD40 receptor and its ligand CD40L/CD154, two cell surface molecules on lymphocytes that are critical for antigen-dependent-B-cell development. It binds to A/T-rich promoters. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | AI597013/AKNA transcript F2/AT hook containing transcription factor |
| Tag: | GST |
| Amino Acid Sequence: | PTSAQPAAKWPPTASPPPARRHRHSIQLDLGDLEELNKALSRAVQAAESV RSTTRQMRSSLSADLRQAHSLRGSCLF |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 1363 to 1439 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0012 | Human AKAP13 Knockout Cell Line | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2571 | Recombinant Human AKNA protein | Inquiry |
| Related Gene / Proteins | |||
| AKAP13 | AKNA | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
