| Cat.No.: | PE-2623 |
| Product Name: | Recombinant Human NHLH1 protein |
| Background: | May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system. |
| Applications: | Western blot; SDS-PAGE; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 41 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.79% Tris HCl, 0.3% Glutathione |
| Accession#: | Q02575 |
| Alternative Names: | bHLHa35/Class A basic helix-loop-helix protein 35/Helix-loop-helix protein 1 |
| Amino Acid Sequence: | MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEP GEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRK LLPTLPPDKKLSKIEILRLAICYISYLNHVLDV |
| Sequence Similarities: | Contains 1 basic helix-loop-helix (bHLH) domain. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 133 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0449 | Human NHEJ1 Knockout Cell Line 4bp deletion | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2580 | Recombinant Human NHLH2 protein | Inquiry |
| PE-2623 | Recombinant Human NHLH1 protein | Inquiry |
| Related Gene / Proteins | |||
| NHEJ1 | NHLH1 | NHLH2 | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
