Recombinant Human KDM3B / JMJD1B protein (Tagged)


  • Specification
  • Related Products
Cat.No.:  PE-2669
Product Name:  Recombinant Human KDM3B / JMJD1B protein (Tagged)
Background:  Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May have tumor suppressor activity.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  46 kDa including tags
Purity:  > 90 % SDS-PAGE.
Species:  Human
Formulation:  Constituents: 50% Glycerol, Tris buffer
Accession#:  Q7LBC6
Alternative Names:  5qNCA/C5orf7/JHDM2B
Tag:  His
Amino Acid Sequence:  MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLI TAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADE VTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPI HDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSC IKVAEDFVSPEHVKHCFRLTQEFR
Sequence Similarities:  Belongs to the JHDM2 histone demethylase family.Contains 1 JmjC domain.
Expression System:  E. coli
Protein Length:  Protein fragment; 1498 to 1721
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.