| Cat.No.: | PE-2694 |
| Product Name: | Recombinant human Aurora B protein |
| Background: | May be directly involved in regulating the cleavage of polar spindle microtubules and is a key regulator for the onset of cytokinesis during mitosis. Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Phosphorylates 'Ser-10' and 'Ser-28' of histone H3 during mitosis. Required for kinetochore localization of BUB1 and SGOL1. Interacts with INCENP. |
| Applications: | Inhibition Assay |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.0462% DTT, 0.395% Tris HCl, 0.05% Tween, 50% Glycerol, 0.58% Sodium chloride |
| Alternative Names: | AIK2/AIM-1/AIM1 |
| Tag: | His, GST |
| Amino Acid Sequence: | AQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTA APGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHF IVALKVLFKSQIEKEGVEHQLRREIEIQAHLHHPNILRLYNYFYDRRRIY LILEYAPRGELYKELQKSCTFDEQRTATIMEELADALMYCHGKKVIHRDI KPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHN EKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPTGAQ DLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA |
| Sequence Similarities: | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.Contains 1 protein kinase domain. |
| Expression System: | Sf9 Insect Cells |
| Post Translational Modifications: | Ubiquitinated by different BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complexes. Ubiquitinated by the BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex, ubiquitination leads to removal from mitotic chromosomes and is required for cytokinesis. During anaphase, the BCR(KLHL21) E3 ubiquitin ligase complex recruits the CPC complex from chromosomes to the spindle midzone and mediates the ubiquitination of AURKB. Ubiquitination of AURKB by BCR(KLHL21) E3 ubiquitin ligase complex may not lead to its degradation by the proteasome. |
| Protein Length: | Full length protein; 2 to 344 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
