| Cat.No.: | PE-2803 |
| Product Name: | Recombinant Human RTCD1 protein |
| Background: | RTCD1 catalyzes the conversion of 3'-phosphate to a 2',3'-cyclic phosphodiester at the end of RNA. The mechanism of action of the enzyme occurs in 3 steps: (A) adenylation of the enzyme by ATP; (B) the enzyme acts on RNA-N3'P to produce RNA-N3'PP5'A; (C) a non catalytic nucleophilic attack by the adjacent 2'hydroxyl on the phosphorus in the diester linkage to produce the cyclic end product. The biological role of this enzyme is unknown but it is likely to function in some aspects of cellular RNA processing. There are two named isoforms. |
| Applications: | Mass Spectrometry; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 42 kDa including tags |
| Purity: | > 85 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | pH: 8.0; Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 0.02% DTT, 20% Glycerol |
| Accession#: | O00442 |
| Alternative Names: | 2310009A18Rik/AI450277/EC 6.5.1.4 |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGSMAGPRVEVDGSIMEGGGQILRVSTALS CLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEI TFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNA EMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQ LNPINLTERGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIRKEIRDLYV NIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEA AEMLLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHF AEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMTNPNL |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 366 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Proteins & Enzymes | ||
| PE-2269 | Recombinant Human RTF1 protein | Inquiry |
| PE-2766 | Recombinant Human RTCD1 protein | Inquiry |
| PE-2803 | Recombinant Human RTCD1 protein | Inquiry |
| ◆ Antibodies | ||
| EAb-3236 | RTT106 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| RTCD1 | RTF1 | RTT106 | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
