Recombinant Human PABPN1 protein (denatured)


  • Specification
  • Related Products
Cat.No.:  PE-2825
Product Name:  Recombinant Human PABPN1 protein (denatured)
Background:  Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product. Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail elongation reaction and controls also the poly(A) tail length. Increases the affinity of poly(A) polymerase for RNA. Is also present at various stages of mRNA metabolism including nucleocytoplasmic trafficking and nonsense-mediated decay (NMD) of mRNA. Cooperates with SKIP to synergistically activate E-box-mediated transcription through MYOD1 and may regulate the expression of muscle-specific genes. Binds to poly(A) and to poly(G) with high affinity. May protect the poly(A) tail from degradation.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  24 kDa including tags
Purity:  > 95 % SDS-PAGE.
Species:  Human
Accession#:  Q86U42
Alternative Names:  Nuclear poly(A)-binding protein 1/OPMD/PAB2
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMGSLEAIKARVREMEEEAEKLKELQNEVEK QMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGC GSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVI PKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRG RARATSWYSPY
Sequence Similarities:  Contains 1 RRM (RNA recognition motif) domain.
Expression System:  E. coli
Post Translational Modifications:  Arginine dimethylation is asymmetric and involves PRMT1 and PRMT3. It does not influence the RNA binding properties.
Protein Length:  Protein fragment; 119 to 306
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.