| Cat.No.: | PE-2851 |
| Product Name: | Recombinant Human ZRANB2 protein |
| Background: | ZRANB2 is a splice factor required for alternative splicing of SFRS10/TRA2B transcripts. It may interfere with constitutive 5'-splice site selection. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | ZRANB 2/DKFZp686J1831/DKFZp686N09117 |
| Tag: | GST |
| Amino Acid Sequence: | MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGT EIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERT GYGGGF |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 1 to 106 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0372 | Human ZRANB1 Knockout Cell Line 14bp deletion | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2851 | Recombinant Human ZRANB2 protein | Inquiry |
| PE-2852 | Recombinant Human ZRANB2 protein | Inquiry |
| Related Gene / Proteins | |||
| ZRANB1 | ZRANB2 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
