| Cat.No.: | EAb-2639 |
| Product Name: | HDAC6 Polyclonal Antibody |
| Product Overview: | Rabbit polyclonal to detect HDAC6 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment (His-tag) corresponding to Human HDAC6 aa 166-348. N-terminal tag. (Expressed in E.coli). |
| Immunogen Sequence: | VLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGH HAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFD QDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMR DADYIAAFLHVLLPVALEFQPQLVLVAAGFDAL |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.4; 0.02% Sodium azide, PBS, 50% Glycerol |
| Applications: | WB, IHC-P |
| Species Reactivity: | Human, Pig |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q9UBN7-1 |
| Alternative Name: | CPBHM antibody/FLJ16239 antibody/HD 6 antibody |
| Scientific Background: | Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0006 | Recombinant Human HDAC1 293 Cell Lysate | Inquiry |
| EL-0007 | Recombinant Human HDAC2 293 Cell Lysate | Inquiry |
| EL-0008 | Recombinant Human HDAC3 Cell Lysate | Inquiry |
| EL-0009 | Recombinant Human HDAC4 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0007 | Tubacin | Inquiry |
| Related Gene / Proteins | |||
| HDAC | HDAC1 | HDAC10 | HDAC11 |
| HDAC2 | HDAC3 | hdac4 | hdac5 |
| HDAC6 | hdac7 | HDAC8 | hdac9 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
