PADI1/PAD1 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2760
Product Name:  PADI1/PAD1 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect PADI1/PAD1
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human PADI1/ PAD1 aa 495-550.
Immunogen Sequence:  PSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQ KCIDWN
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol
Applications:  IHC-P, ICC/IF
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9ULC6
Alternative Name:  HPAD10 antibody/Padi1 antibody/PADI1_HUMAN antibody
Scientific Background:  Catalyzes the deimination of arginine residues of proteins.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.