PARP7 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2995
Product Name:  PARP7 Polyclonal Antibody
Product Overview:  Rabbit polyclonal to detect PARP7
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human PARP7 aa 231-326.
Immunogen Sequence:  QYHTHQENGIEICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQS VFNDSQEHLERFYCNPENDRMRMKYGGQEFWADLNAMNVYETTEFD
Host:  Rabbit
Isotype:  IgG
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  pH: 7.20; 0.02% Sodium azide, PBS, 40% Glycerol
Applications:  IHC-P
Species Reactivity:  Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q7Z3E1
Alternative Name:  ADP-ribosyltransferase diphtheria toxin-like 14 antibody/ARTD14 antibody/AW558171 antibody
Scientific Background:  Poly [ADP-ribose] polymerase using NAD(+) as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor; repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. May play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.