| Cat.No.: | EAb-3295 |
| Product Name: | KDM5B Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 784-883 of human KDM5B |
| Immunogen Sequence: | EESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEE |
| Host: | Rabbit |
| Isotype: | IgG |
| Molecular Weight: | 176kDa |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IF |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Positive Control: | MCF7,HeLa,DU145,K562 |
| Species Reactivity: | Human |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q9UGL1; NP_006609.3; Gene ID 10765 |
| Alternative Name: | KDM5B; CT31; JARID1B; PLU-1; PLU1; PPP1R98; PUT1; RBBP2H1A; RBP2-H1; lysine demethylase 5B |
| Scientific Background: | This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing results in multiple transcript variants. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
| CL-0087 | Human KDM1A Knockout Cell Line 10bp deletion | Inquiry |
| CL-0088 | Human KDM1B Knockout Cell Line 13bp deletion | Inquiry |
| CL-0089 | Human KDM2B Knockout Cell Line 14bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0071 | KDM1B Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| KDM1 | KDM1A | KDM1B | KDM2 |
| KDM2A | KDM2B | KDM3A | KDM3B |
| KDM4 | KDM4A | KDM4B | KDM4C |
| KDM4D | KDM4E | KDM5 | KDM5A |
| KDM5B | KDM5C | KDM5D | KDM6A More > |
| KDM6B | KDM6C | KDM7 | KDM7A |
| KDM7B | KDM8 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
