| Cat.No.: | EAb-3299 |
| Product Name: | PADI4 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 374-550 of human PADI4 |
| Immunogen Sequence: | RGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNR |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Affinity purification |
| Appearance: | Liquid |
| Applications: | WB; IHC |
| Recommended Dilutions/Conditions: |
WB: 1:500 - 1:2000; IHC: 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20℃. |
| Storage Buffer: | PBS with 0.02% sodium azide,50% glycerol,pH7.3. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Swiss Prot Q9UM07; NP_036519.2; Gene ID 23569 |
| Alternative Name: | PADI4; PAD; PAD4; PADI5; PDI4; PDI5; peptidyl arginine deiminase 4 |
| Scientific Background: | This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0059 | PARP Monoclonal Antibody | Inquiry |
| EAb-0061 | PARP Polyclonal Antibody | Inquiry |
| EAb-0062 | PARP (Cleaved) Polyclonal Antibody | Inquiry |
| EAb-0063 | PARP (Cleaved) Polyclonal Antibody | Inquiry |
| EAb-0064 | Paf1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| PABPC1L2A | PABPC5 | PABPN1 | PAD |
| PAD1 | PAD2 | PAD3 | PAD4 |
| PADI1 | PADI2 | PADI3 | PADI4 |
| PADI6 | PAF1 | PAN2 | PAPD1 |
| PAPD4 | PAPD5 | PAPD7 | PAPOLA More > |
| PAPOLB | PARD6A | PARG | PARK2 |
| PARK7 | PARP | PARP1 | PARP10 |
| PARP11 | PARP12 | PARP14 | PARP15 |
| PARP16 | PARP2 | PARP3 | PARP4 |
| PARP6 | PARP7 | PARP8 | PARP9 |
| PAX5 | PAX6 | PAX7 | PAX9 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
