| Cat.No.: | PE-0516 |
| Product Name: | Recombinant Human CCND1, His-tagged |
| Product Overview: | Recombinant full length protein, corresponding to amino acids 1-295 of Human Cyclin D1, with N terminal His tag, 295 amino acids. In addition to the coding region for Cyclin D1 this protein carries the following N-terminal sequence: MRGSHHHHHHGSYLGDTIESST |
| Description: | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Mutations, amplification and overexpression of this gene, which alters cell cycle progression, are observed frequently in a variety of tumors and may contribute to tumorigenesis. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitution with 87 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAP SVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVF PLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKET IPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMT PHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVK FISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRF LSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI |
| Sequence Similarities: | Belongs to the cyclin family. Cyclin D subfamily. |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | CCND1 cyclin D1 [ Homo sapiens ] |
| Gene ID NCBI: | 595 |
| Official Symbol: | CCND1 |
| Synonyms: | CCND1; cyclin D1; BCL1, cyclin D1 (PRAD1: parathyroid adenomatosis 1) , D11S287E, PRAD1; G1/S-specific cyclin-D1; B cell CLL/lymphoma 1; G1/S specific cyclin D1; parathyroid adenomatosis 1; U21B31; |
| mRNA Refseq: | NM_053056 |
| Protein Refseq: | NP_444284 |
| MIM: | 168461 |
| UniProt ID: | P24385 |
| Chromosome Location: | 11q13 |
| Function: | cyclin-dependent protein kinase regulator activity; enzyme binding; protein binding; protein kinase activity; protein kinase binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0060 | Recombinant Human CCND1 293 Cell Lysate | Inquiry |
| EL-0120 | Recombinant Human CCNB1 Cell Lysate | Inquiry |
| EL-0197 | Recombinant Human CCDC101 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0515 | Recombinant Human Cyclin D1, GST-tagged | Inquiry |
| PE-0516 | Recombinant Human CCND1, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| CCDC101 | CCL14 | CCNB1 | CCND1 |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
