| Cat.No.: | PE-0574 |
| Product Name: | Recombinant Human SSRP1, His-tagged |
| Product Overview: | Recombinant fragment, corresponding to amino acids 274-709 of Human SSRP1 with an N terminal His tag. Predicted MWt: 51 kDa; |
| Description: | The protein encoded by this gene is a subunit of a heterodimer that, along with SUPT16H, forms chromatin transcriptional elongation factor FACT. FACT interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT and cisplatin-damaged DNA may be crucial to the anticancer mechanism of cisplatin. This encoded protein contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified DNA. This protein also functions as a co-activator of the transcriptional activator p63. An alternatively spliced transcript variant of this gene has been described, but its full-length nature is not known. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Species: | Human |
| Formulation: | Lyophilised:Reconstitute with 133 μl aqua dest. |
| Tag: | His |
| Amino Acid Sequence: | ILLFSKDEDISLTLNMNEEEVEKRFEGRLTKNMSGSLYEM VSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGL LYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNAKKLNIKNRG LKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENA NDSSDDSGEETDESFNPGEEEEDVAEEFDSNASASSSSNE GDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPN APKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGE IWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGGRGESSK RDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESFK SKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPS SEDSASGSDE |
| Expression System: | E. coli |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SSRP1 structure specific recognition protein 1 [ Homo sapiens ] |
| Gene ID NCBI: | 6749 |
| Official Symbol: | SSRP1 |
| Synonyms: | SSRP1; structure specific recognition protein 1; FACT complex subunit SSRP1; facilitates chromatin remodeling 80 kDa subunit; FACT80; |
| mRNA Refseq: | NM_003146 |
| Protein Refseq: | NP_003137 |
| MIM: | 604328 |
| UniProt ID: | Q08945 |
| Chromosome Location: | 11q12 |
| Function: | DNA binding; protein binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0067 | Recombinant Human SSRP1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0574 | Recombinant Human SSRP1, His-tagged | Inquiry |
| PE-0575 | Recombinant Chicken SSRP1 | Inquiry |
| PE-0576 | Recombinant Rat SSRP1 Protein | Inquiry |
| PE-0577 | Recombinant Rhesus monkey SSRP1 Protein, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| SSBP4 | SSRP1 | Ssu72 | |
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
