| Cat.No.: | PE-0731 |
| Product Name: | Recombinant Human SOD3 |
| Product Overview: | Recombinant fragment, corresponding to amino acids 26-125 of Human Superoxide Dismutase 3, with an N-terminal proprietary tag, predicted MWt 36.63 kDa |
| Description: | This gene encodes a member of the superoxide dismutase (SOD) protein family. SODs are antioxidant enzymes that catalyze the dismutation of two superoxide radicals into hydrogen peroxide and oxygen. The product of this gene is thought to protect the brain, lungs, and other tissues from oxidative stress. The protein is secreted into the extracellular space and forms a glycosylated homotetramer that is anchored to the extracellular matrix (ECM) and cell surfaces through an interaction with heparan sulfate proteoglycan and collagen. A fraction of the protein is cleaved near the C-terminus before secretion to generate circulating tetramers that do not interact with the ECM. |
| Tissue Specificity: | Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36.630kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | EPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGTLHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGC |
| Sequence Similarities: | Belongs to the Cu-Zn superoxide dismutase family. |
| Expression System: | Wheat germ |
| Protein Length: | 100 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SOD3 superoxide dismutase 3, extracellular [ Homo sapiens ] |
| Gene ID NCBI: | 6649 |
| Official Symbol: | SOD3 |
| Synonyms: | SOD3; superoxide dismutase 3, extracellular; extracellular superoxide dismutase [Cu-Zn]; EC SOD; |
| mRNA Refseq: | NM_003102 |
| Protein Refseq: | NP_003093 |
| MIM: | 185490 |
| UniProt ID: | P08294 |
| Chromosome Location: | 4pter-q21 |
| Function: | copper ion binding; heparin binding; metal ion binding; oxidoreductase activity; protein binding; |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0090 | Recombinant Human SOD3 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0730 | Recombinant Human SOD3 | Inquiry |
| PE-0731 | Recombinant Human SOD3 | Inquiry |
| PE-0732 | Recombinant Human SOD3, GST-tagged | Inquiry |
| PE-0733 | Recombinant Mouse SOD3 Protein | Inquiry |
| Related Gene / Proteins | |||
| SOD1 | SOD2 | SOD3 | Sox11 |
| Sox2 | Sox6 | ||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
