| Cat.No.: | PE-0802 |
| Product Name: | Recombinant Human SUZ12 |
| Product Overview: | Recombinant fragment corresponding to amino acids 640-739 of Human SUZ12 with a propreitary tag at N-terminal; predicted mwt: 36.63 kDa. |
| Description: | This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region. |
| Tissue Specificity: | Overexpressed in breast and colon cancer. |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36.630kDa inclusive of tags |
| Species: | Human |
| Amino Acid Sequence: | VENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL |
| Sequence Similarities: | Belongs to the VEFS (VRN2-EMF2-FIS2-SU(Z)12) family.Contains 1 C2H2-type zinc finger. |
| Expression System: | Wheat germ |
| Protein Length: | 100 amino acids |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Gene Name: | SUZ12 suppressor of zeste 12 homolog (Drosophila) [ Homo sapiens ] |
| Gene ID NCBI: | 23512 |
| Official Symbol: | SUZ12 |
| Synonyms: | SUZ12; suppressor of zeste 12 homolog (Drosophila); polycomb protein SUZ12; CHET9; JJAZ1; KIAA0160; |
| mRNA Refseq: | NM_015355 |
| Protein Refseq: | NP_056170 |
| MIM: | 606245 |
| UniProt ID: | Q15022 |
| Chromosome Location: | 17q21 |
| Function: | chromatin binding; histone methyltransferase activity; metal ion binding; methylated histone residue binding; protein binding; |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0020 | Suz12 Polyclonal Antibody | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0100 | Chaetocin | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0103 | Recombinant Human SUZ12 293 Cell Lysate | Inquiry |
| EL-0132 | Recombinant Human SUV39H1 293 Cell Lysate | Inquiry |
| EL-0137 | Recombinant Human SUV420H1 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| SUDS3 | SUMO | SUMO1 | SUMO2 |
| SUMO3 | SUN1 | Surf6 | suv39h1 |
| SUV39H2 | SUV3L1 | SUV420H1 | SUV420H2 |
| SUZ12 | |||
USA
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools
